PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P25670_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 190aa    MW: 21869.2 Da    PI: 9.9058
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P25670_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-182982356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                            k+++++ eq ++Le+ Fe +++++ +++ +LA+ lgL+ rqV vWFqNrR ++k
  GSMUA_Achr10P25670_001 29 KKRRLSMEQARALEKNFEVENKLDPARKLRLAQDLGLQPRQVAVWFQNRRSRWK 82
                            45689************************************************9 PP

2HD-ZIP_I/II1253.4e-4028120193
             HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 
                             ekkrrls eq+++LE++Fe e+kL+p rK +la++LglqprqvavWFqnrR R+ktkq+E+dy  Lk+++dalk + ++L++++e+L
  GSMUA_Achr10P25670_001  28 EKKRRLSMEQARALEKNFEVENKLDPARKLRLAQDLGLQPRQVAVWFQNRRSRWKTKQVERDYGNLKAQHDALKLDCDALRHDKEAL 114
                             69************************************************************************************* PP

             HD-ZIP_I/II  88 reelke 93 
                              +e+++
  GSMUA_Achr10P25670_001 115 IAEIRD 120
                             999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.5032484IPR001356Homeobox domain
SuperFamilySSF466891.07E-182685IPR009057Homeodomain-like
SMARTSM003892.8E-172788IPR001356Homeobox domain
PfamPF000466.5E-162982IPR001356Homeobox domain
CDDcd000862.01E-142985No hitNo description
Gene3DG3DSA:1.10.10.605.3E-193190IPR009057Homeodomain-like
PRINTSPR000311.9E-55564IPR000047Helix-turn-helix motif
PROSITE patternPS0002705982IPR017970Homeobox, conserved site
PRINTSPR000311.9E-56480IPR000047Helix-turn-helix motif
PfamPF021833.6E-1684125IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MVKDEAFLLD GMEEMECEEE LRSNGLGEKK RRLSMEQARA LEKNFEVENK LDPARKLRLA  60
QDLGLQPRQV AVWFQNRRSR WKTKQVERDY GNLKAQHDAL KLDCDALRHD KEALIAEIRD  120
LKAKLSASEM DAAEEARPPL IYWKKEKPNS AVRKSLSVRA VGFKMRAVKI NNFICAGCFG  180
KQKHISNTIG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17684RRSRWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381829.13e-96PREDICTED: homeobox-leucine zipper protein HOX13-like
SwissprotQ9XH378e-50HOX4_ORYSI; Homeobox-leucine zipper protein HOX4
SwissprotQ6K4988e-50HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4
SwissprotQ10QP31e-49HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLM0RLE11e-138M0RLE1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P25670_0011e-138(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.17e-46homeobox protein 6